Browse Products By Molecule:

Products --> ActiveMax® Cytokines

ActiveMax® Recombinant Human VEGF110 (HPLC-verified)  pdf  pdf  pdf


Cat-Pack Size Price(USD) Qty Inventory Order
Quote for bulk   Worldwide Shipping & Payment
VE0-H5212-20ug
    $540.00
VE0-H5212-200ug
    $2500.00
In-Stock
Place Purchase Orders


Synonym

RP1-261G23.1,MGC70609,MVCD1,VEGFA,VPF

Source

ActiveMax® Human VEGF110 (VE0-H5212) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 136 (Accession # NP_001165097).

Predicted N-terminus: Ala 27

Molecular Characterization

VEGF110(Ala 27 - Arg 136)NP_001165097

This protein carries no "tag".

The protein has a calculated MW of 12.6 kDa. As a result of glycosylation, The protein migrates as 18-20 kDa under reducing (R) condition and 40-45 kDa (homodimer) under non-reducing (NR) condition on SDS-PAGE gel.

This product does not contain a heparin binding domain, and therefore doesn't bind with heparin.

Endotoxin

Less than 1.0 EU per μg by the LAL method.

 

Purity

>95% as determined by SDS-PAGE.

>95% as determined by SEC-HPLC.

Formulation

Lyophilized from 0.22 μm filtered solution in PBS, pH7.4. Normally trehalose is added as protectant before lyophilization.

Contact us for customized product form or formulation.

Reconstitution

Please see Certificate of Analysis for specific instructions.

For best performance, we strongly recommend you to follow the reconstitution protocol provided in the CoA.

Storage

For long term storage, the product should be stored at lyophilized state at -20°C or lower.

Please avoid repeated freeze-thaw cycles.

No activity loss is observed after storage at:

  1. 4-8°C for 12 months in lyophilized state;
  2. -70°C for 3 months under sterile conditions after reconstitution.
 

SDS-PAGE

ActiveMax® Human VEGF110 (Catalog # VE0-H5212) SDS-PAGE gel

ActiveMax® Human VEGF110 on SDS-PAGE under reducing (R) and no-reducing (NR) conditions. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.

SEC-HPLC

ActiveMax® Human VEGF110 (Catalog # VE0-H5212) HPLC images

The purity of ActiveMax® Human VEGF110 (Cat.# VE0-H5212) was greater than 95% as determined by SEC-HPLC.

 

Bioactivity

ActiveMax® Human VEGF110 (Catalog # VE0-H5212) ELISA bioactivity

Immobilized ActiveMax® Human VEGF110 (Cat# VE0-H5212) at 2 μg/mL (100 μL/well) can bind VEGFR2 / R3-Fc with a linear range of 0.15-5 ng/mL (QC tested).

Request for protocol

ActiveMax® Human VEGF110 (Catalog # VE0-H5212) ELISA bioactivity

Immobilized ActiveMax® Human VEGF110 (Cat# VE0-H5212) at 2 μg/mL (100 μL/well) can bind Human VEGF R1 Protein, His Tag (Cat# VE1-H5220) with a linear range of 3-100 ng/mL (Routinely tested).

Request for protocol

 

Amino Acid Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDR

Background

Vascular endothelial growth factor (VEGF), also known as vascular permeability factor (VPF) and VEGF-A, and is a member of the platelet-derived growth factor (PDGF)/vascular endothelial growth factor (VEGF) family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. Alternatively spliced isoforms of 110,121,145,165,183,189 and 206 amino acids in length are expressed in humans.

References

Please contact us via TechSupport@acrobiosystems.com if you have any question on this product.