Browse Products By Molecule:

This web search service is supported by Google Inc.

Products --> Viral Proteins

Recombinant HBV (Subtype adw) HBsAg, low endotoxin  pdf  pdf  pdf


Cat-Pack Size Price(USD) Qty Inventory Order
Quote for bulk   Worldwide Shipping & Payment
HBG-V5711-100ug
    $260.00
HBG-V5711-1mg (200ug x 5)
    $1320.00
In-stock
Place Purchase Orders


Synonym

HBsAg ,adw,Small S,HBV

Source

Recombinant Hepatitis B Surface Antigen adw Subtype (rHBsAg-adw) was produced in Yeast cells(Saccharomyces cerevisiae).

Predicted N-terminus: Met 1

Molecular Characterization

HBsAg(Met 1 - lle 226)

This protein carries no "tag".

The protein has a calculated MW of 24 kDa. The protein migrates as 24 kDa under reducing (R) condition (SDS-PAGE).

Endotoxin

Less than 0.05 EU per μg by the LAL method.

Purity

>97% as determined by SDS-PAGE.

Formulation

Lyophilized from 0.22 μm filtered solution in PBS, pH7.4.

Contact us for customized product form or formulation.

Reconstitution

Please see Certificate of Analysis for specific instructions.

For best performance, we strongly recommend you to follow the reconstitution protocol provided in the CoA.

Storage

For long term storage, the product should be stored at lyophilized state at -20°C or lower.

Please avoid repeated freeze-thaw cycles.

No activity loss is observed after storage at:

  1. 4-8°C for 12 months in lyophilized state;
  2. -70°C for 3 months under sterile conditions after reconstitution.
 

SDS-PAGE

HBV (Subtype adw) HBsAg (Cat. No. HBG-V5711) SDS-PAGE gel

HBV (Subtype adw) HBsAg on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 97%.

 

Citations

Amino Acid Sequence

MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSA IWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI

Background

Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. At the center of the hepatitis B virus is DNA, which contains the genes the virus uses to replicate itself. Surrounding the DNA is a protein called HBcAg (hepatitis B core antigen), which cannot be detected with blood tests. Surrounding this is HBsAg, which is actually part of the protective "envelope." This envelope surrounds the virus and protects it from attack by the body's immune system. HBsAg stands for hepatitis B surface antigen and is the surface antigen of the Hepatitis-B-Virus (HBV) S-gene. The capsid of a virus has different surface proteins from the rest of the virus. The antigen is a protein that binds specifically on one of these surface proteins. It is commonly referred to as the Australian Antigen.

References

Please contact us via TechSupport@acrobiosystems.com if you have any question on this product.

Related Products

Questions & Comments