Browse Products By Molecule:

This web search service is supported by Google Inc.

Products --> Viral Proteins

Recombinant HBV (Subtype adw) HBsAg, low endotoxin  pdf  pdf  pdf


Cat-Pack Size Price(USD) Qty Inventory Order
Quote for bulk   Worldwide Shipping & Payment
HBG-V5711-100ug
    $260.00
HBG-V5711-1mg (200ug x 5)
    $1320.00
In-stock
Place Purchase Orders


Synonym

HBsAg, adw,Small S

Source

Recombinant Hepatitis B Surface Antigen adw Subtype (rHBsAg-adw) was produced in Yeast cells(Saccharomyces cerevisiae).

Molecular Characterization

rHBsAg-adw full length monomeric protein contains 226 amino acids (Met 1 - Ile 226) and the has a calculated MW of 24 kDa.The predicted N-terminus is Met.The reducing (R) protein migrates as 24 kDa in SDS-PAGE.

Endotoxin

Less than 0.05 EU per μg by the LAL method.

Purity

>97% as determined by SDS-PAGE.

Formulation

Lyophilized from 0.22 μm filtered solution in 6.2 mM Phosphate, 200 mM NaCl bufer, pH 7.2. Normally Mannitol or Trehalose are added as protectants before lyophilization.

Contact us for customized product form or formulation.

Reconstitution

See Certificate of Analysis for reconstitution instructions and specific concentrations.

Storage

Avoid repeated freeze-thaw cycles.

No activity loss was observed after storage at:
In lyophilized state for 1 year (4oC); After reconstitution under sterile conditions for 3 months (-70oC).

 

SDS-PAGE


Recombinant HBV HBsAg Antigen, Subtype adw
rHBsAg-adw on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 97%.
 
 

Citations

Amino Acid Sequence

MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVL
LDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPT
VWLSA IWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI

Background

Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. At the center of the hepatitis B virus is DNA, which contains the genes the virus uses to replicate itself. Surrounding the DNA is a protein called HBcAg (hepatitis B core antigen), which cannot be detected with blood tests. Surrounding this is HBsAg, which is actually part of the protective "envelope." This envelope surrounds the virus and protects it from attack by the body's immune system. HBsAg stands for hepatitis B surface antigen and is the surface antigen of the Hepatitis-B-Virus (HBV) S-gene. The capsid of a virus has different surface proteins from the rest of the virus. The antigen is a protein that binds specifically on one of these surface proteins. It is commonly referred to as the Australian Antigen.

Please contact us via TechSupport@acrobiosystems.com if you have any question on this product.


References

Related Products