0
There is no goods in the shopping cart !
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 0-9
Your Position: Home > Receptor Tyrosine Kinases > EGF R > Biotinylated Human EGFRvIII / EGF R / ErbB1, Avi Tag (Avitag™)

Biotinylated Human EGFRvIII, Avi Tag (Avitag™)

  • Synonym
    EGFRvIII
  • Source
    MABSol®Biotinylated Human EGFRvIII (Cat. No. EGR-H82E0) is expressed from human 293 cells (HEK293). It contains AA Leu 25 - Ser 645 (30-297: Val Cys Gln...Cys Pro Arg → Gly) (Accession # NP_005219.2).
    Predicted N-terminus: Leu 25
  • Molecular Characterization
    EGFRvIII(25-29 & 298-645) NP_005219.2

    This protein carries an Avi tag (Avitag™) at the C-terminus, followed by a polyhistidine tag.

    The protein has a calculated MW of 41.3 kDa. As a result of glycosylation, the protein migrates as 60-70 kDa under reducing (R) condition, and 60-70 kDa under non-reducing (NR) condition (SDS-PAGE).

  • Biotinylation
    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.
  • Biotin:Protein Ratio
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin
    Less than 1.0 EU per μg by the LAL method.
  • Purity

    >95% as determined by SDS-PAGE.

  • Formulation

    Lyophilized from 0.22 μm filtered solution in PBS, pH7.4. Normally trehalose is added as protectant before lyophilization.

    Contact us for customized product form or formulation.

  • Reconstitution

    Please see Certificate of Analysis for specific instructions.

    For best performance, we strongly recommend you to follow the reconstitution protocol provided in the CoA.

  • Storage

    For long term storage, the product should be stored at lyophilized state at -20°C or lower.

    Please avoid repeated freeze-thaw cycles.

    No activity loss was observed after storage at:

    1. 4-8°C for 12 months in lyophilized state;
    2. -70°C for 3 months under sterile conditions after reconstitution.
SDS-PAGE
Biotinylated Human EGFRvIII, His Tag (Cat. No. EGR-H82E0) SDS-PAGE gel

Biotinylated Human EGFRvIII, His Tag on SDS-PAGE under reducing (R) and no-reducing (NR) conditions. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.

Bioactivity-ELISA
Biotinylated Human EGFRvIII, His TagBiotinylated Human EGFRvIII, His Tag (Cat. No. EGR-H82E0) ELISA bioactivity

Immobilized CetuxiMabat 2 μg/mL (100 μL/well) can bind Biotinylated Human EGFRvIII (Cat. No. EGR-H82E0) with a linear range of 0.4-25 ng/mL (QC tested).

  • Amino Acid Sequence

    LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSGLNDIFEAQKIEWHEHHHHHH

  • Background
    The epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. The epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). Mutations affecting EGFR expression or activity could result in cancer. The type III EGF deletion-mutant receptor (EGFRvIII) is the most common mutation and was first identified in primary human glioblastoma tumors; EGFR gene amplification is correlated with the structural rearrangement of the gene. The EGFRvIII gene has an in-frame deletion of 801 base pairs, corresponding to exons 2–7 in the mRNA, resulting in the deletion of amino acids 30-297 in the extracellular domain and the generation of a glycine at the fusion point.
  • References
  • Limited Use License

    The Biotin AviTag technology is covered by U.S. Pat. No: 5,874,239 and includes any and all materials, methods, kits and related derivatives claimed by this patent. The purchase of the Acrobiosystems’s Avitag™ proteins confers to the purchaser the limited right to use the Avitag™ technology for non-commercial, or research use, or for purposes of evaluating the Avitag™ technology.

    Commercial use of the Avitag™ technology to manufacture a commercial product, or use of the Avitag™ technology to facilitate or advance research which will be applied to the development of a commercial product requires a license from Avidity, LLC. Examples of Commercial use include, but are not limited to biosensors, diagnostics, therapeutic applications, proximity assays, and drug screening assays.

  • Please contact us via TechSupport@acrobiosystems.com if you have any question on this product.

Comments (0)

This web search service is supported by Google Inc.

totop